How It Works

• You book and pay securely online

• We meet at the specified starting point

• Our guides, Carina & Carina, lead the tour at a relaxed pace

• You gain new knowledge and a memorable experience

Everything is planned down to the smallest detail so you can experience as much as possible. In just a few short hours, you’ll truly get to know Småland. You’ll enjoy the stories, flavors, anecdotes, and personal encounters. Along the way, a packed lunch and tastings of local artisanal food are served. All you need to do is show up and enjoy the ride.

Who is the tour for?

Our guided cycling tours are perfect for you if you:

• Travel solo, as a couple, or with family

• Want to be active without it being strenuous

• Appreciate nature, culture, and local stories and flavors

• Are looking for a memorable experience you’ll carry with you for a long time

• Are interested in Astrid Lindgren’s life, books, and films

• Seek sustainable experiences in Sweden

• Want to learn more about Småland and its local cultural heritage

• Want to meet real Smålanders

• Want to experience something extraordinary during your stay in Vimmerby or Eksjö

The pace is relaxed and adapted to the group.

What previous guests say

“Excellent experience! Great organization! And on top of that, interesting stories about the town. I can warmly recommend this excursion!”

“A very pleasant cycling tour at a perfect pace and distance! Wonderful guides with a sense of humor, great knowledge, and a deep love for the local area. They guided us through the creation of the Emil films in beautiful Mariannelund. Highly recommended!”

“Fantastically well organized! So much knowledge and so many stories to share, and such a beautiful and sustainable way to get around!”

“The guides are amazing—so knowledgeable and professional! They really take care of you and do everything they can to make you feel special. On top of that, they treat you to local delicacies and are rightly proud of their wonderful little corner of Småland. Thank you for giving me this experience! I highly recommend the guided cycling tours in the film landscape—you’ll take home a memory for life!”

“Carina and Carina are engaging joy-spreaders who generously share themselves.”

“A cycling tour you won’t forget anytime soon!”

More reviews can be found on Tripadvisor, where we have received the Travellers’ Choice award three years in a row.

Frågor & svar

• • Can I ride my own bike?

    A bike is always included in the tour, but if you prefer to ride your own bike, you are of course welcome to do so. Please indicate this when booking so we know not to bring a bike for you. The price remains the same.

    Is the tour suitable for children?

    The short 5 km tour is absolutely suitable for children.
    The 17 km tour is suitable for children who are used to cycling longer distances.

    We offer junior bikes (24” and 26”) that can be booked through our digital booking system. You may also bring your child’s own bike.

    The long tour is operated only with e-bikes, which makes it difficult for children who cannot ride an adult-sized bike. However, children in a bike seat or trailer are welcome.

    Not sure? Send us an email at info@cyklaifilmlandskapetsmaland.se

  • Can I cycle on my own without a guide?

    We only offer guided cycling tours.
    If you wish to rent a bike and cycle on your own, we recommend Motorsport in Vimmerby och Cykelsmedjan in Eksjö.

    I need a special diet – can I still book a tour?

    Yes! We offer vegetarian and vegan options, as well as meals free from gluten, lactose, and milk protein.
    Please indicate your dietary requirements when booking.

    Can I stay overnight nearby?

    Yes, there are several accommodation options nearby.
    In Mariannelund, we recommend Pensionat Solhöjden.
    Within a short drive, you’ll also find Fredensborga Herrgård (Storebro), Hotel Ullinge (Eksjö), and Wallby Säteri (Vetlanda).

    How do we get to Mariannelund?

    From the railway hub Nässjö, bus 325 runs to Mariannelund every hour.
    From Linköping and Kalmar, take the train to Vimmerby and then change to bus 325.

    The bus stop in Mariannelund center is located right by the square where the short tours start (5 km and 17 km).
    If you’ve booked the long tour (30 km), get off at Filmbyn Småland and have a nice walk to Spilhammars Camping.

    If you are traveling by car, take Route 40 from Gothenburg or Västervik to Mariannelund.

    What happens if the weather is bad?

    We recommend dressing for the weather. We adapt the tour and go ahead even if it rains.
    In case of thunderstorms, the tour will be cancelled, and you will receive a refund or the option to rebook for another day.

    You can also purchase a rebooking guarantee in the booking system, allowing you to reschedule regardless of the reason.

    Will we see filming locations from Astrid Lindgren’s films?

    Yes. The short tours (5 and 17 km) take you to locations where the indoor scenes from Emil of Lönneberga were filmed and include plenty of local stories and anecdotes from the time the films were made in Mariannelund.

    The long tour (30 km) takes you to Emil’s Katthult and the real Noisy Village (Bullerbyn).

    Can I buy a gift card for a guided cycling tour in the Film Landscape?

    Yes, gift cards can be purchased online and paid for easily and securely through our booking system.
    Click the BOOK button at the top right of this page.

  • Is it possible to book a bike seat or trailer for small children?

    Yes. We offer children seats, trailers, and tag-along bikes that attach to an adult bicycle.
    These can be added as extras when booking your place in our digital booking system, where payment is also handled securely.